Philip Morris
the P53 Tumor Suppressor Targets A Novel Regulator of G Protein Signaling
Fields
- Author
- Buckbinder, L.
- Chen, Y.
- Gao, J.
- Gelbert, L.
- Gutkind, J.S.
- Kley, N.
- Seizinger, B.R.
- Talbott, R.
- Velascomiguel, S.
- Xu, N.
- Type
- PSCI, PUBLICATION SCIENTIFIC
- BIBL, BIBLIOGRAPHY
- Area
- CARCHMAN,RICHARD/OFFICE
- Litigation
- Iwoh/Produced
- Characteristic
- EXTR, EXTRA
- MARG, MARGINALIA
- Site
- R530
- Named Organization
- Princeton Univ
- Author (Organization)
- Proc Natl Acad
- Bristol Meyers Squibb Pharmaceutical Res
- Genome Therapeutics
- Lab of Cellular Development + Oncology
- Molecular Signaling Unit
- Nas, Natl Academy of Sciences
- Natl Inst of Dental Research
- NIH, Natl Inst of Health
- Named Person
- Kley, N.
- Shenk, T.E.
- Master ID
- 2063633486/4072
- 2063633486-4072 Book 7 Tabs 1-68
- 2063633488-3498 Predicting Rodent Carcinogenicity From Mutagenic Potency Measured in the Ames Salmonella Assay
- 2063633500-3505 Workplace Conditions, Socioeconomic Status, and the Risk of Mortality and Acute Myocardial Infarction: the Kuopio Ischaemic Heart Disease Risk Factor Study
- 2063633507-3510 Environmental Exposure to Gasoline and Leukemia in Children and Young Adults - An Ecology Study
- 2063633512-3530 Behavioral Functions of Nucleus Accumbens Dopamine: Empirical and Conceptual Problems with the Anhedonia Hypothesis
- 2063633532-3543 the Use of A Urine Mutagenicity Assay in the Monitoring of Environmental Exposure to Genotoxins
- 2063633545-3553 Smoking and Relative Body Weight: An International Perspective From the Who Monica Project
- 2063633555-3562 Aromatic Amine Dna Adduct Formation in Chronically-Exposed Mice: Considerations for Human Comparison
- 2063633564-3570 Life-Style Factors and Female Infertility
- 2063633571 Sensitivity of the Relation Between Cumulative Magnetic Field Exposure and Brain Cancer Mortality to Choice of Monitoring Data Grouping Scheme
- 2063633573-3584 Genetic Risk Factors for Chronic Obstructive Pulmonary Disease
- 2063633586-3593 Risk Factors Associated with the Development of Peripheral Arterial Disease in Smokers: A Case-Control Study
- 2063633595-3609 Self-Regulation and Mortality From Cancer, Coronary Heart Disease, and Other Causes: A Prospective Study
- 2063633611-3620 Dna Damage in Nasal Respiratory Epithelium From Children Exposed to Urban Pollution
- 2063633622-3630 Co-Carcinogenic Effects of Various Agents in Rats Following Exposure to Radon and Radon Daughters
- 2063633632-3638 Genetics and the Origin of Species: An Introduction
- 2063633640-3647 Subjective Indoor Air Quality in Schools in Relation to Exposure
- 2063633649-3662 the Nurses' Health Study: 20-Year Contribution to the Understanding of Health Among Women
- 2063633664-3671 Polymorphisms of Cyp1a1 and Gstm1 Influence the in Vivo Function of Cyp1a2
- 2063633673-3677 Quantitative Evaluation of Multiplicity in Epidemiology and Public Health Research
- 2063633679-3681 Abc of Allergies Asthma and Allergy
- 2063633683-3684 Inflammatory Responses and Coronary Heart Disease the 'dirty Chicken' Hypothesis of Cardiovascular Risk Factors
- 2063633685 Consultant Suspended for Not Getting Consent for Cardiac Procedure. Mmr Vaccine Policy Is Backed
- 2063633687-3690 When Can Odds Ratios Mislead?
- 2063633692-3699 Increased Responsiveness of Ventral Tegmental Area Dopamine Neurons to Glutamate After Repeated Administration of Cocaine or Amphetamine Is Transient and Selectively Involves Ampa Receptors
- 2063633701-3703 Association Between Cigarette Smoking and Fhit Gene Alterations in Lung Cancer
- 2063633705-3712 Genetic Testing for Susceptibility to Adult - Onset Cancer the Process and Content of Informed Consent
- 2063633714-3721 Release of Carbon Granules From Cigarettes with Charcoal Filters
- 2063633723-3731 Detection of Low - Fraction K-Ras Mutations in Primary Lung Tumors Using A Sensitive Method
- 2063633733-3740 Socioeconomic Level, Sedentary Lifestyle, and Wine Consumption As Possible Explanations for Geographic Distribution of Cerebrovascular Disease Mortality in Spain
- 2063633742-3750 Air Pollution and Daily Admissions for Chronic Obstructive Pulmonary Disease in 6 European Cities: Results From the Aphea Project
- 2063633751 Airway Obstruction and Rheumatoid Arthritis
- 2063633753-3756 Relationship Between Acetylator Status, Smoking, Diet and Colorectal Cancer Risk in the North-East of England
- 2063633758-3763 Cardiovascular Risk Factor Profile in Subjects with Familial Predisposition to Myocardial Infarction in Denmark
- 2063633765-3770 Effect of Fresh Fruit Consumption on Lung Function and Wheeze in Children
- 2063633772-3777 Interactive Effect of the P53 Gene and Cigarette Smoking on Coronary Artery Disease
- 2063633779-3784 P53 Gene Aberrations in Non-Small-Cell Lung Carcinomas From A Smoking Population
- 2063633786-3794 Interlaboratory Comparison of Pm10 and Black Smoke Measurements in the Peace Study
- 2063633796-3799 Statistical Significance - A Misconstrued Notion in Medical Research
- 2063633801-3808 Urinary 1-Hydroxypyrene As A Marker of Exposure to Pyrene: An Epidemiological Survey on A General Population Group
- 2063633810-3813 Genetic Polymorphism of Cytochrome P450 As A Biomarker of Susceptibility to Environmental Toxicity
- 2063633815-3824 Smoking Among Psychiatric Patients
- 2063633826-3831 Evaluation of Certain Risk Factors for Lung Cancer in Cracow (Poland)
- 2063633833-3840 Prevalence and Predictive Value of P53 Mutation in Patients with Oesophageal Squamous Cell Carcinomas: A Prospective Clinico-Pathological Study and Survival Analysis of 70 Patients
- 2063633842-3848 Ki-Ras Mutations in Exocrine Pancreatic Cancer: Association with Clinico-Pathological Characteristics and with Tobacco and Alcohol Consumption
- 2063633850-3859 Risk Factors for Raynaud's Phenomenon Among Workers in Poultry Slaughterhouses and Canning Factories
- 2063633861-3880 Molecular Events in Lung Carcinogenesis
- 2063633882-3885 Cyp1a1, Cyp2e1 and Gstm Polymorphisms Are Not Associated with Susceptibility to Squamous - Cell Carcinoma of the Esophagus
- 2063633893-3896 New Tumor Suppressor Found - Twice. Prepaper Publicity Ignites Race to Publish. Shape- Changing Crystals Get Shiftier
- 2063633898-3899 Who Reform and Global Health
- 2063633901-3903 Showdown Over Clear Air Science. Puzzling Over A Potential Killer's Modus Operandi
- 2063633905-3910 Polymorphisms in the Glutathione S-Transferase Class Mu and Theta Genes Interact and Increase Susceptibility to Lung Cancer in Minority Populations (Texas, United States)
- 2063633912-3927 Plant Foods and Colon Cancer: An Assessment of Specific Foods and Their Related Nutrients (United States)
- 2063633929 Smoking, Alcohol and Coffee Consumption, and H Pylori Infection
- 2063633931-3934 Grand Rounds at the Clinical Center of the National Institutes of Health Evaluating Coronary Heart Disease Risk Tiles in the Mosaic
- 2063633936-3939 New Clues to Asthma Therapies. Why the Rise in Asthma Cases? New Lead to Safer Marrow Transplants
- 2063633941-3946 Cancer Undefeated
- 2063633948-3964 Lung Tissue Responses and Sites of Particle Retention Differ Between Rats and Cyanomolgus Monkeys Exposed Chronically to Diesel Exhaust and Coal Dust
- 2063633966-3986 Implementation on Epa Revised Cancer Assessment Guidelines: Incorporation of Mechanistic and Pharmacokinetic Data
- 2063633988-3999 Particle Pollution and Sudden Infant Death Syndrome in the United States Policy Memorandum
- 2063634001-4007 Neighborhood Social Environments and the Distribution of Low Birthweight in Chicago
- 2063634009-4014 the Effects of Cigarette Smoking and Gestational Weight Change on Birth Outcomes in Obese and Normal-Weight Women
- 2063634016-4017 Annotation: Cigarette Smoking, Nutrition, and Birthweight
- 2063634019-4020 Helicobacter Pylori Infection and Coagulation in Healthy People
- 2063634022-4023 Prospective Study of Helicobacter Pylori Seropositivity and Cardiovascular Diseases in A General Elderly Population
- 2063634025-4027 Age Specific Trends in Asthma Mortality in England and Wales, 830000 - 950000: Results of An Observational Study
- 2063634029-4036 Childhood Leukemia and Electromagnetic Fields: Results of A Population - Based Case - Control Study in Germany
- 2063634038-4047 Association of Smoking, Body Mass, and Physical Activity with Risk of Prostate Cancer in the Iowa 65+ Rural Health Study (United States)
- 2063634049-4056 Tobacco and Non-Hodgkin's Lymphoma: Combined Analysis of Three Case-Control Studies (United States)
- 2063634058-4063 How Much Pain for Cardiac Gain?
- 2063634065-4071 A Prospective Study of Body Mass Index, Weight Change, and Risk of Stroke in Women
Related Documents:
Document Images
Proa Natl. Acad. Sd. USA
Vol. 94, pp. 7868-'/872, 3-1y 1997
Biochermstry
The p53 tumor suppressor targets a novel regulator of
G protein signaling
LEONARD BUCKBINDER*, SUSANA VELASCO=IV[IGUEL*, YAN CHEN*, N~N~Z~ XU$, RANDY TALBOTr*,
LARRY GELBERT~, JIZONO OAO*, BERND R. SEIZINOER*§, J. SILVIO GIYlXIND~', AND NIKOLM KLEY*§¶
• Department of Molecular Genefic~ and *Biomolecular Drug Discovery, Oncology, Bri~toi-Myer~
Squibb Pharmaceutical Research Institute, D.O. Box 4000,
Princeton, NJ 08543; and ~'Molecuiar Signaling Unit, Laboratory of Cellular Development and
Oncology, National Institute of Dental Research, National
rmstitute~ of Health. Bethesda, MD 20892
. .
Communicated by Thomas E. Shenk, Princeton University, Princeton, NJ, May & 1997 (received for
review December 20, 1996)
ABSTRACT Heterotrimeric G proteins transduce multi-
ple growth.factor.receptor-initiated and intracellular signals
that may lead to activation of the mitogen-activated or stress-
activated protein kinases. Herein we report on the identifica-
tion of a novel p53 target gene (A28-RGS14) that is induced
in response to genotoxic stress and encodes a novel member
of a family of regulators of G protein signaling (RGS) proteins
with proposed GTPase-activating protein activity. Overex-
• pression of A28.RGS14p protein inhibits both G~- and Gq-
coupled growth.factor-receptor-mediated activation of the
mitogen-activated protein kinase signaling pathway in mam-
malian cells. Thus, through the induction ofA28-RGS14, p53
may regulate cellular sensitivity to growth and/or survival
factors acting through G protein-coupled receptor pathways.
Inactivation of the p53 tumor suppressor protein is the most
common aberration known to occur in human cancers (1). As
a consequence of loss of wild-type p53 functions, cells are
defective in critical, cell cycle checkpoints as well as intracel-
lular and extracellular pathways regulating cellular growth and
programmed cell death (2-5). Several pS3-induced target
genes that encode a complex spectrum of regulators of such
pathways have been identified. For instance, p21wA~t (6)
mediates pS3-induced cell cycle arrest and may exert protective
effects against apoptosis (7), whereas bax (8) encodes a
positive effector of cell death. Induction of IGF-BP3, an
inhibitor of insulin-like growth factors, provides a mechanism
whereby pS3 may interfere with the mitogenic and survival
functions of insulin-like growth factors, thereby further sen-
sitiT./ng ceils to apoptotic stimuli (S). Cell-specific integration
of the activity, of such and yet to be identified p53-regulated
pathways is intimately associated with cell fate of normal and
tumorigenic cells. To gain further insight into p53 signaling
pathways, we undertook a screen to clone nov.el pS3 target
genes. Herein we report the identification of a novel factor
induced by p53 that can inhibit G protein-coupled mitogenic
signal transduction and activation of the mitogen-activated
protein kinase (MAPK) signaling cascade implicated in cel-
lular proliferation, transformation, and oncogenesis.
MATERIALS AND METHODS
Cell Culture. EBI colon carcinoma cells (9) were cultured
as described (S). RKO and RKO E6 colon carcinoma cells were
cultured at 37~C and 5% CO2/95% air in modified Eagle's
medium supplemented with 10% fetal bovine serum (FBS)
and penicillin-streptomycin (GIBCO/BRL). NIH 3T3 MI and
M2 cells were cultured as described (10). T98G glioblastoma,
The publication costs of this article wer, defrayed in part by page charge
payment. This article must therefore be hereby marked "advertiaement'" in
accordance with 18 U,S.C. §1734 solely to indicate this fact.
~) 1997 by The National Academy of Sciences 0027.8424/97/947868-552.00/0
PNAS is available, online at http://www.pnas.org.
U-87 astrocytoma, HL-60 promyelocytic leukemia, and MCF7
breast carcinoma cells were obtained from American Type
Culture Collection and maintained at 37°C and 5% CO2/95%
air in RPMI 1640 medium supplemented with 10% FBS and
penicillin-streptomycin (100 units/ml) (GIBCO/BRL).
MCF7 Adr (11) and MCF 7 clone 6 (clonal population derived
from the parental cells) were cultured as the parental MCF7
cells were cultured.
RNA and Northern Blot Analysis. RNA preparation and
Northera blot analysis were as described (12). Quantitation of
"Northern blots was performed with laser densitometry (Mo-
lecular Dynamics) of the autoradiograms or by exposing the
blots to phosphorimaging plates followed by analysis on a
phosphorimager (Fuji).
eDNA Isolation and Cloning. A PCR-based h'brary subtrac-
tion procedure was used to enrich for eDNA fragments
• representing RNAs induced by p53 (12). One fragment, A28,
detected an ,-2.5-kb p53-regulated transcript and was used as
a probe to screen a human brain eDNA library in X ZAPII
(Stratagene). Several independent clones were identified and
isolated as pBluescript plasmids by phagemid rescue (Strat-
agene). A28-15B, the longest clone, was sequenced in both
directions by automated DNA sequencing (Applied Biosys-
terns) using vector- and gene-specific primers. A28-15B was
1969 nt and all other clones were found to be 5' truncated
versions of this sequence. Thus, none of the identified clones
appeared to be full-length. Additional upstream sequence was
obtained by using 5' rapid amplification of eDNA ends
(CLONTECH) and RNA obtained from cadmium chloride-
stimulated (10 h) EBI cells (12). This additional 416 nt of
eDNA sequence was confirmed by sequencing the correspond-
ing genomic region from a cosmid clone (L.B., R.T., N.K., and
L.G., unpublished results).
Plasmid Construction. The 5' fragment obtained from rapid
amplification of eDNA ends was subcloned into a unique BglII
restriction site near the 5' end of A28-15B, yielding a recom-
binant full-length clone (2383 nt). The entire A28-RGS14
sequence (where RGS is regulators of G protein signaling) was
excised by EcoRI digestion and subeloned into the/n vivo/in
v/tro expression vector (pCDNA3), yielding pIGIL4 (sense) or
pAS3 (antisense).
In V'ffro Interaction of A28.RGS14 with Ga Protein. A28-
RGS14 was expressed in baculovirus as a polyhistidine fusion
protein (pBlueBacHis, Invitrogen) and purified by chroma-
tography using nickel-agarose (Qiagen, Chatsworth, CA). Ga
Abbreviations: MAPK. rnitogen-activated protein kinase; RGS, reg-
ulators of G protein signaling; HA, hemagglutinin.
Data deposition: The sequences reported in this paper have been
deposited in the C~nBank database (accession nos. U70426 and
U70427).
§Current address: Oenome Therapeutics Corporation, Waltham, MA
02154.
~tTo whom reprint requests should be addressed, e-maiL Kley@
genomecorp.com.
7868

Biochemistry: Buckbindcr et al.
Proc.-Natl. Acad. Sci. USA 94 (1997) 7869
proteins (13) were expressed and labeled with [35S]mcthionine
by using a coupled in vitro transcription-translation system
(TNT, Promcga). Conditions for in vitro interaction and eo-
immunoprecipitation were as described (rcf. 16 and Y.C., I.,B.,
and N.tC, unpublished results).
~luscarinic Receptor Signaling and MAPK Activity. Plas-
:~..5 encoding the M1 or M2 muscarinic receptors (1 tzg per
plate) were eotransfected with a pcDNA3-A28-RGS14 eDNA
expression vector and a plasmid encoding hemagglutinin
(HA)-taggcd MAPK (ERK2). Total transfccted DNA was
maintained constant with an empty expression vector
(pCDNA.3). After treatment with Carbachol (100 /~M) or
phorbol 12-myristate 13-acetate (100 ng/ml), ceils were lysed
and ERK activity was assayed on anti-HA immunoprecipitates
as described (13), Radioactivity incorporated into myelin basic
protein was quantitated with a Molecular Dynamics Phospho-
rlmagcr. Total input MAPK was monitored by Western blot
~ .~.Iysis using anti-HA (Boehringer Mannhcim) monoclonal
~ ,~ibody as described (13). A28-RGS14 expression was mon-
itored with a monoelonal antibody (Y.C., L.B., and N.K.,
unpublished results).
RESULTS AND DISCUSSION
As described (12), a 'differential eDNA cloning approach was
used to identify novel p53 target genes potentially implicated
in cellular growth control. This led to the isolation of a eDNA
fragment derived from a novel gene induced by both exoge-
nous and endogenous wild-type p53. Fig. 1 describes studies
~. ated to the regulation of the expression of this gene, called
A28-RGS14, by wild-type p53. A28-RGS14 transcript expres-
sion is rapidly induced upon activation of an inducible p53
transgene in human EB1 colon carcinoma cells (Fig. 1A). The
magnitude and time course of induction is comparable to that
observed for other known p53 response genes, such as
p21w~a~l, and similar to that observed in other human cells
types carrying inducible p53 transgenes (12). Subsequent
studies addressed the inducibility of the A28-RGS14 gene by
endogenous p53. Consistent with the A28-RGS14 gene being
induced upon activation of endogenous wild-type p53, and thus
"o in response to genotoxie stress, treatment of RKO colon
~.,rcinoma cells with the anticancer and DNA damaging agent
doxorubiein leads to induction of A28-RGS14 transcripts (Fig.
1B). No such induction was observed in RKO-E6 cells in which
p53 signaling is defective as a result of the human papilloma-
virus E6 viral protein promoting degradation of p53 (Fig. 1B).
Importantly, experiments using an anti-A28-RGS14p mono-
clonal antibody have shown that A28-RGS14p protein is only
detected in RKO and EB1 cells after p53 induction (Y.C., L.B.,
and N.K., unpublished results). As observed for other known
p53 target genes, such as the bax and p21wAFt genes, the basal
~wels of A28-RGS14 mRNA were found to vary somewhat
th cell type, tissue type, and cell culture conditions (Figs. 1C,
2C, and 3B), which is likely to reflect the complex regulation
of this gene by p53-dependent and p53-independent mecha-
nisms. However, eousistent with results obtained with RKO
cells (Fig. 1B), A28-RGS14 transcripts were found to be
induced by doxorubicin only in ceils expressing wild-type p53
and not in p53 mutant or null cells (Fig. 1C). Thus, these
findings suggest a role for endogenous p53 in the induction of
the A28-RGS14 gene in response to genotoxie stress in human
cells. Curiously, no induction of A28-RGS14 mRNA was
~bserved in mouse embryonic fibroblasts in response to p53
duction. Whether this reflects a cell-specific or species-
pccific phenomenon remains to bc determined.
A
A28-RGS14
EB1
B
Dox. (uM)
c
A28-RGS14
A28-RGS14
p21
GAPDH
MCF-7
T98G U.87 HL-60 ~ #6 AdrR
C D C D C 0 C D C O C D
hdm-2
FIO. 1. Regulation of A28-RGS14 gene expression by p53 and
genotoxie stress. (A) Regulation by exogenous p53. The metallothio-
nein-promoter driven p53 transgene in EB1 colon carcinoma cells (9)
was induced by the addition of CdClz (6 t~M) to the cell culture
medium. Total RNA or protein was prepared from cells at the times
(in hours) indicated. Northern blots (A) were prepared and analyzed
by hybridization with 32P-labeled eDNA probes corresponding to
A28-RGS14, p21wAl:l, p53, or GAPDH. (B) Induction of A28-RGS14
expression by endogenous p53. Northern blot analysis of RKO (colon
carcinoma ceils, wild-type p53) and clonal RKO-E6 cells (express
human papillomavirus E6 viral protein and consequently do not
express significant levels of p53) treated with increasing concentra-
tions of doxorubicin for 16 h. (C) Induction of A28-RGS14 transcripts
in human cells that are wild type (WT) (MCF-7, breast carcinoma
cells; MCF-7 subclone 6; U87, astrocytoma cells) but not mutant
(T98G; glioblastoma cells, MCF-7Adr.: doxorubicin-resistant MCF7
subelone) or null (HL-60, promyeloeytie leukemia cells) for p53. Cell
lines were treated with (lanes D) or without (lanes C) doxorubicin (1
/~M) for 16 h. RNA was prepared and analyzed by Northern blot as
described in A.
p53 in a human osteosareoma cell line, even in the absence of
ongoing protein synthesis, as we have shown (12); and (iii) the
induction of A28-RGS14 transcripts by p53 is not a general
consequence of cells arresting in a particular stage of the cell
The following observations indicate that the A28-RGS14 cycle, as demonstrated
by the lack of induction in ceils blocked
gene might be a direct p53 response gene: (i) A28-R~S14 in G~ (serum deprived),
S (thymidine treated) or G~/M
transcripts are rapidlv induced in response to p53 expression (nocodozole treated)
phases of the cell cycle (data not shown).
(Fig. 1A); (ii) A28-~GS14 transcripts are induced by the Thus, induction of
A28-RGS14 is an early p53 response. To
conditional activation of a temperature-sensitive mutant of determine whether this
might be mediated via direct activation

7870 Biochemistry: Buckbinder et al.
Prec. Natl. Acad. Sci. USA 94 (1997)
A
mu28-RG814
1
M~RTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTG~TGKSEWGSKHSKENRNF~EDVLGWRESFDLLLSSKNGVAA~HA~LKTEFSEENLEFWLAcEE
F I01
1
MCRTLATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGISKFEWASKHNKENRSFSEDVLGWRESFDLLLNSKNGVAAFHAFLKTESSEENLEFWLACEE
F 101
h~
B
A28-RGSI4
RGS2
GAIP
RGS 1
A28-RGSI4
RGS2
GAIP
RGSI
EGL 10
SS~2
A28-RGSI4
RGS2
GAIP
RGSI
EGLI0
SsU2
102
KK7RSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSH
T 202
102
KKIRSATKLASRAHQIFEEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSTSVPSGSPAEPSH
T
202
1 ,M~-~L...~PT~ ........ ~ ................ ~-~H ,E~ELGCD~GS T~/G~
................ .....
HSKEAXlRNF S~--~GWR~ SFDLLL SSKNGV~ZiKTEFSEENLEFW'gdkC EEF K~I RSATI~.~.~kSRAHQ:I:F E EP
QQAF "r KP S P~E~LWS,~dLFDEL/.~SKYGZdMkFRAF/.,KSF.~IF_~WIdkCEDFKKTKS PQKL S S~K~YTDF
C EW'CAT P S P~ SWAQ SFDKLI~-IS PAGRSVFRA~LRTEYS EF, NM~F~CEELIrOkF.NkNQHVVDEIrOkRLIYEDY
........ 2~q]~IQWSQSLEKL~NM~IQTC-~NV~GS~LKSESSE~NI EFWI.dkCEDYKKTES . DLLPCKiLEEIYKA~
......... 417. LWEDS~'EELZd~DSLGRET~QK~LDKER'SGENLR~INgP~QI~RKCSS o RblVP~EI~IF-~
......... 416 . SNI.a'ZK~DYVLTDP~IRYLPRRtL~EKELCVENLDVF IEIKRFLK. 45 8 ~ ............
~ ....
L E EN
r CSEAP. KEVNZ.DrrSTR~-,TRtm'~QTATATC~'D~Q~TRTY.a.flZKD~P~KSPA~QAS~TLS S 193
"r EK~P. KEINZ~FQTKTL ~QNIQF-,A~SGC~'I~tQt~tVY~PR~LESEL~'YQDLCKK PQ ~ ~ P~T 211
V S :I:L S P. ICdZVS LD S RVREG:~Clr,.I~QEPS~h'I~'DD~Qr.Q~SY~RF~SSP TYRA~ L L QG P S
(~S S F.dk 217
Wr~SDAA. KQ~IDF~TREST~m~:~:Ir~PTP~DFdtQ~v.~k'T~YP~LKS D ~L~LQ~K 196
IDIOTS ~C~ED~P~W~D~YC~SYQ~LRS E~L 536
........................ . .... ..~ ...... 66~ FEIV~SF~TQS~AS~IEIQE 688
F ~ S F S Y
D +
+
~ + + + +
+
.
97.4Kd .... '
66Kd --- _~
46Kd --
30Kd --
8012 (antt-A28)
His-A28 35
Gu(IVT-S )
Abl(anti-p53)
His-p53
hdm2 (IVT-S35)
FIG. 2. A28-RGS14 gcne encodes a novel conserved RGS protein. (A) Predicted protein sequences of
human and mouse A28-RGS14p prote~
(B) Alignment of A28-RGS14p amino acid sequence and that of related mammalian, yeast, and C. elegans
RGS protein family members. Shaded-~:~
areas indicate a 130-amino acid cor~ domain with highest sequence conservation and a predicted
a-helical structure. (C) Tissue expression pattem:~
of the A28-RGS14 gent. A human multitissuc Northern blot (CLONTECI-I) was hybridized with a
32p-labeled A28-RGS14 eDNA probe a~_~
described in Fig. IA. (D) In vitro interaction of A28-RGS14p with (~oti2, but not Gc~ subunits of
heterotrimerie G proteins. The in vitro-translated=,~
3~S-labeled Ga proteins were coimmunoprecipitated with purified His-tagged A28-RGS14p (His-A28) and
anti-A28-RGS14p antibody 801~
(Ab-8D12; Y.C., LB., and N.K., unpublished results). Lanes: 1, in vitro-translated Ga; 2,
coirnmunopreeipitation of Ga with His-A28-RGS14p tm~
Ab-SD 12; 3, coimmunoprccipitation of Ga without His-A28-RGSI4p; 4, coimmunopreeipitation of/n
v/tro-translated Ga with purified His-tagl~
p53 (His-p53) and its specific antibody (Ab-1, Oncogenc Science); 5, eoimmunoprceipitation of in
vitro-translated hdm2 protein wi~
His-A28-RGS14p and Ab-8DI2. m.w.m., M.olecular mass markers. ~
by p53, genomie analysis of the A28-RGS14 gene was per- other putative p53 binding sites in
sequences extending to ~ I_""~
kb upstream of the putative transcription start site
N.K., unpublished data).
putative p53-binding sites are encoded by sequences
further upstream of the transcription start site,
the p21wA~t gene (6), and whether any putative binding
may cooperate in p53-mediated induction of A28-RGS14
expression.
Screening of eDNA libraries, 5' rapid amplification
eDNA ends (RACE) analyses, and genomic analyses
formed.
Purified p53 was found to bind to DNA elements resembling
the consensus p53-binding sequence (14) and located in intron
3 (not shown) and the 3' untranslated region (5'-
TGGGCTAGCCCAGAGTCCCTtAGCTTGTaC-Y, where
underlined type represents p53 half sites and lowercase type
represents divergent nuctcotides) of the 7.5-kb A28-RGS14
gene, although it is as yet unclear whether these mediate p53
responsiveness in vivo. Computer analysis did not reveal any

A
Biochemistry: Buckbinder et al.
~ MBP
Fold Induction
FtG. 3. (4) A28-RGS14 coexpression blocks agonist-indueed ac-
tivation of ERK2 in M1- or M2-transfected COS-7 cells. Plasmids
encoding M1 or M2 muscarinie receptors were cotransfceted with a
peDNA3-A28-RGS14 eDNA vector or empty, expression vector, as
indicate& and a plasmid encoding HA-tagged MAPK (ERK2). Ceils
were exposed to Carbaehol (100 txM) or phorbol 12-myristate 13-
acetate (100 ng/ml) for 5 min and lysed, and ERK activity was assayed
on anti-HA immunoprecipitates. After autoradiography, radioactivity
incorporated into myelin basic protein (MBP) was quantitated with a
' lecular D.vnamies Phosphorlmagcr. Data represent the mean -
":M of six to eight experiments, expressed as fold increase with
respect to veetor-transfectcd ceils (control). Fifty. micrograms of total.
lysate proteins was subjected to Western blot analysis using anti-HA
or anti-A28-RGS14 mouse monoclonal antibodies (Ab-ICS; Y.C.,
L.B., and N.K., unpublished results). (B) Induction of A28-RGS14
expression in response to mitogenic signals--a potential role as
negative feedback regulator. NIH 3T3 cells expressing the musearinie
M1 receptor (10) were grown to confluence, transferred to serum-free
medium (DMEM containing 0.1% BSA) for 16 h. and then stimulated
with or without Carbachol (50 tzM) or fetal bovine serum (10%) for
• in Fig. L4). Autoradiograms were analyzed by laser densitometric
~anning (Applied Biosystems) and the signal was normalized to
GAPDH control.
that this novel gene encodes a new member of an evolutionarily
highly conserved gene family that encodes proteins implicated
in the regulation of G protein signaling (regulators of G
protein signaling or RGS proteins: refs. 15-17). It is in keeping
Prec. Natl. Acad. Sci. USA 94 (1997) 7871
with the numbering system for. predicted RGS proteins that
this gene was named A28-RGS14 and the protein product be
named A28-RGS14p. On the basis of translation of cloned
eDNA sequences, both human and mouse A28-RGS14 genes
encode predicted proteins of 202 amino acids with 86% amino
add identity and 90% similarity (Fig. 2A). These share high
homology over a core region of 130 amino acids to other
members of this family found in species as distant asAspergillus
nidulans (18), yeast (19), and Caenorhabditis elegans (17) (Fig.
2B). The predicted A28-RGS14p protein is closely related to
the human RGSl (BL34) and RGS2. (GOSS) proteins, en-
coded by genes i~iduced in activated B cells and peripheral
blood mononudca.r cells, respectively (20, 21). However, RNA
expression stutlfes indicate that the A28-RGS14 gene is widely
expressed in human tissues (Fig. 2C), in contrast to some other
members of this family, including RGS1 and RGS2, which
show more tissue-specific expression patterns. As reported for
RGS1 (20), expression of A28-RGS14 was also detected in
activated B cells (data not shown), but of several RGS genes
analyzed to date only A28-RGS14 was found to be induced by
p53 (LB. and N.K, unpublished data).
First indications as to a potential role of this new class of
proteins in cellular signaling came from studies in yeast (19).
In Saccharorayces cerevisiae, pheromone signaling is mediated
through a seven-transmcmbrane-domain receptor and is cou-
pled via a G protein to downstream events leading to activation
of the MAPK pathway. It is the/3T moiety of the G protein that
activates downstream signaling leading to growth arrest in the
(St phase of the cell cycle. However, pheromone signaling also
promotes expression of the RGS protein Sst2p, which in turn
mediates subsequent desensitization to pheromone and recov-
ery from growth arrest. Genetic and biochemical studies
~dicate that Sst2p controls pheromone signaling through
direct interaction with the coupling G protein Gpalp (19, 22).
Importantly, recently reported studies showed that the mam-
malian RGS1 and RGS4 proteins can complement the func-
tion of the yeast homologue Sst2p in a yeast pheromone
desensitization assay. Alternatively, they regulate signaling by
G protein-coupled receptors in human B cells (15), suggesting
that these proteins encode structurally and functionally con-
served regulators of G protein-linked signaling pathways.
These may, however, not necessarily involve plasma-
membrane receptor-coupled signaling pathways. Thus, the
subunit of G~, a G protein involved in intracellular trafficking
through the Golgi, directly interacts with GAIP in yeast and in
vitro (16). GAIP does not appear to interact with
indicating specificity for interaction with G~xi3 (16). As dem-
onstrated for the yeast Sst2p protein, these findings also
indicate that mammalian RGS proteins may operate by directly
interacting with a subunits of specific G proteins, disrupting
receptor-G protein interaction or acting at the level of the G
protein itself. Recent biochemical studies with GAIP and
RGS4 have shown that RGS proteins can act as GTPase
activating proteins, accelerating the rate of hydrolysis of all
tested members of the Gi subfamily of G protein a subunits
(23). Preliminary studies indicate that A28-RGS14p can also'
interact with members of the Gi/Go subfamily of G proteins,
including Gaiz, but not Gas in vitro (Fig. 2D and Y.C., L.B., and
N.K., unpublished results). Thus, A28-RGS14p may possibly
act as a more general inhibitor of Gi/Go transduced signaling.
Accordingly, we tested whether A28-RGS14p could regu-
late plasma-membrane receptor-initiated and G protein-
transduced signaling in intact cells. We chose to study a well
characterized system in which activation of Gi-coupled M2
musearinie receptor results in G protein/33,-subunit-mediated
Ras-dependent activation of the MAPK pathway (13) (the
mammalian pathway related to the yeast pheromone response
pathway). In addition, we tested the effects on Gq-coupled M1
muscarinic receptor signaling, which is also associated with
induction of growth signals and activation of the MAPK

7872 Biochemistry: Buckbinder et al.
pathway. COS-7 cells were transiently cotransfected with
mammalian expression constructs encoding M1 or M2 recep-
tors, an HA-tagged-MAPK fusion protein, and a pcDNA3
plasmid expressing A28-RGS14p or pcDNA3 control vector.
Cells were stimulated with the muscarinic agonist Carbachol
and MAPK activity was assayed in anti-HA immunoprecipi-
tates from cell lysates (Fig. 3A). Pronounced activation of
MAPK was observed upon activation of either M1 or M2
receptors. This activation was markedly reduced (-70%) in
ceils coexpressing exogenous A28-RGS14p (Fig. 3,4). Immu-
noblot data indicate that the inhibition of MAPK activity by
A28-RGS14p did not result from a change in the level of
expressed HA-MAPK. Furthermore, the inability of A28-
RGS14p to inhibit phorbol 12-myristate 13-acetate-induced
activation of MAPK (Fig. 3A) indicates that inhibition is
specific and occurs upstream of Raf Idnase, consistent with a
proposed role for RGS proteins as direct regulators of G
proteins. The findings that A28-RGS14p interacts with (Fig.
2/) and data not shown) and regulates signal transduction
implicating both Grtike and Gq proteins, suggest that it may
encode an important negative regulator of extra and intracel-
lular mitogenic signals associated with the activation of diverse
G protein-coupled signaling cascades (among which the
MAPK pathway would only be one example). These may
include/3~- and o,-subtmit-activated pathways. In this context,
it is ~ of interest to note that (3i2a, which also interacts with
A28-RGS14p in vitro (Fig. 2D), is encoded by the gip2
protooncogene found mutated in certain human tumors (24).
In its capacity as an RGS protein, A28-RGS14p may not
only act as a mechanism for p53 to exert cellular growth control
by acting upstream of the ras-raf-MAPK pathway but also as
a negativ¢ feedback regulator in response to mitogenic signals.
Thus, similar to regulation of the Sst2p RGS protein upon
pheromone stimulation in yeast, A28-RGS14 gene expression
i~ induced by serum growth factors and activation of G
protein-coupled receptors (Fig. 3B). This activation is con-
served between human and monse and appears to be p53-
independent (S.V., L.B., and N.K., unpublished data). Thus,
these data implicate A28-RGS14p in a mammalian desensiti-
zation response and as a new signaling molecule whereby p53
may regulate cellular sensitivity to mitogenie and possibly
apoptotic signals in human cellff. Additional studies should
address in more detail the integrated role of A28-RGS14 in
p53 signaling and speeifieities of interactions of various mem-
bers of the RGS family of proteins with heterotrimerie G
proteins.
Proc. Natl. Acad. Sci. USA 94 (1997)
The RKO cell lines were kindly provided by Dr. Michael B. Kastan.
EB and EB1 colon carcinoraa ceils were the gift of Dr. P. Shaw. We
thank C. Molloy for insightful diseussiorm and X. Villarreat for
automated DNA sequencing assistance.
1. Hollstein, M., Sidransky, D., Vogelstein, B. & Harris, C. (1991)
Science 253, 49-53.
2. HartwelL L H. & Ka~tan, M. B. (1994) Science 266, 1821-1828.
3. Ko, Lff. & Prive,, C. (1996) Gene.s Dee. 10, 1054-1072.
4. Dameron, K.M., Volpert, O. V., Tainsky, M.A. & Bounk, N.
(1994) Science 265, 1582-t584.
5. Buckbinder, L, Talbott, R., Velasco-Miguel, S., Takenaka, I.,
Faha, B., Seizinger, B. R. & Kley, N. (1995) Nature (London) 377,
646-649.
6. F_..lZDeiry, W:.~., Tokino, T., Velculescu, V.E., Levy, D.B.,
Parsons, R.,Trent, J. M., Lira, D., Mercer, N. E., Kinzler, K. W.
& Vogeistein, B. (1993) Cell 75, 817-825.
7. Polyak, K., Waldman, T., He, T.-C., Kinzler, IC W. & Vogeistein,
B. (1996) Genes Dee. 10, 1945-t952.
8. Miyashita, T. & Reed, J. C. (1995) Cell 80, 293-299.
9. Shaw, P., Bovey, 1L, Tardy, S., Sahli, R., Sordat, B. & Costa, J.
(1992) Prec. Natl. Acad. Sci. USA 89, 4495-4499.
10. Gutkind, J. S., Novotny, E.A., Brann, M. 1L & Robbins, K.C.
(1991) Prec. Natl. Acad. ScL USA 88, 4703-4707.
11. Cowan, K. H.,Batist,G.,Tulpule, A.,Sinha,B. K.&Myers, C. E.
(1986) Prec. Natl. Acad. Sci. USA 83, 9328-9332,.
12. Buckbinder, L, Talbott, IL, Seizinger, B. 1L & Kley, N. (1994)
Proc. NatL Acad. ScL USA 91, 10640-10644.
13. Crespo, P., Xu, N., Simon~, W. F. & Gutldnd" 3. S. (1994) Namm
(London) 369, 418-420.
14. El-Deity, W. S., Kern, S. E., Pietenpol, J.A., Kinzler, K.W. &
Vog¢istein, B. (1992) Nat. Genet. 1, 45-49.
15. Druey, K. M., Blumer, K.J., Kang, V. H. & Kehrl, J. H. (1996)
Nature (London) 379, 742--746.
16. De Vrie,, L., Mousli, M., Wttrmser, A. & Farquhar, M. G. (1995)
Proc. Natl. Acad. Scl. USA 92, 11916-11920.
17. Koetle, M. R. & Horvitz, H. R. (1996) Cell 84, 115-125.
18. Admm, T. H., Hide, W. A., Yager, L N.& Lee, B. N. (1992) MoL
Cell. Biol. 12, 3827-3833.
19. Dohlman, H. G., Apaniesk, D., Chen, Y., Song, ft. & Nusskem,
D. (1995) MoL Cell. Biol. 15, 3635-3643.
20. Hong, J.X., Wilson, G. L, Fox, C.H. & Kehrt, J.H. (1993)
d. Immunol. 150, 3895-3904.
21. Siderovski, D. P., Heximer, S. P. & Forsdyke, D. R. (1994) DNA
Cell. BioL 13, 125-147.
22. Dohlman, H. G., Song, J., Ms, D., Courchesne, W. E. & Thorner,
J. (1996) Mol. Cell. Biol. 16, 5194-5209.
23. Berman, D. M., Wilkie, T. M. & Gilman, A. G. (1996) Cell 86,
445-452.
24. Lyotm, J., Landis, C. A., Marsh, G., Vallar, L., Grunewald, K., et
a/. (1990) Science 249, 655-659.
